Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      QMTQTFGFRDSEITHLVNAGVLTVRDAGSWWLAVPGAGRFIKYFVKGRQA VLSMVRKAKYRELLLSELLGRRAPVVVRLGLTYHVHDLIGAQLVDCISTT SGTLLRLPET
    • Amino acids
      255 to 364
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160228 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as STK19.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • D6S60
    • D6S60E
    • G11
    • HLA RP1
    • MGC117388
    • MHC class III HLA RP1
    • Nuclear serine/threonine protein kinase
    • OTTHUMP00000062682
    • Protein G11
    • Protein RP1
    • RP 1
    • RP1
    • Serine/threonine kinase 19
    • Serine/threonine protein kinase 19
    • STK 19
    • STK19
    see all
  • Relevance
    STK19 belongs to the serine/threonine protein kinase family. The specific function of this protein is unknown. In vitro it can phosphorylate casein-alpha on serine and threonine residues and histones on serine residues.
  • Cellular localization
    Nuclear

Images

  • ab160228 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160228 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160228.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up