Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSASTGGGGDSGGSGGSSSSSQASCGPESSGSELALATPVPQMLQGLLGS DDEEQEDPKDYCKGGYHPVKIGDVFNGRYHVVRKLGWGHFSTVWLCWDIQ RKRFVALKVVKSAGHYTETAVDEIKLLKCVRDSDPSDPKRETIVQLIDDF RISGVNGVHVCMVLEVLGHQLLKWIIKSNYQGLPVPCVKSIVRQVLHGLD YLHTKCKIIHTDIKPENILLCVGDAYIRRLAAEATEWQQAGAPPPSRSIV STAPQEVLQTGKLSKNKRKKMRRKRKQQKRLLEERLRDLQRLEAMEAATQ AEDSGLRLDGGSGSTSSSGCHPGGARAGPSPASSSPAPGGGRSLSAGSQT SGFSGSLFSPASCSILSGSSNQRETGGLLSPSTPFGASNLLVNPLEPQNA DKIKIKIADLGNACWVHKHFTEDIQTRQYRAVEVLIGAEYGPPADIWSTA CMAFELATGDYLFEPHSGEDYSRDEDHIAHIVELLGDIPPAFALSGRYSR EFFNRRGELRHIHNLKHWGLYEVLMEKYEWPLEQATQFSAFLLPMMEYIP EKRASAADCLQHPWLNP
    • Amino acids
      1 to 567
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162014 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MSSK-1
    • MSSK1
    • Muscle specific serine kinase 1
    • Muscle-specific serine kinase 1
    • Serine/arginine rich protein specific kinase 3
    • Serine/arginine-rich protein-specific kinase 3
    • Serine/threonine protein kinase 23
    • Serine/threonine protein kinase SRPK3
    • Serine/threonine-protein kinase 23
    • SFRS protein kinase 3
    • SR-protein-specific kinase 3
    • Srpk3
    • SRPK3_HUMAN
    • SRSF protein kinase 3
    • STK 23
    • STK23
    see all
  • Function
    Serine/arginine-rich protein-specific kinase which specifically phosphorylates its substrates at serine residues located in regions rich in arginine/serine dipeptides, known as RS domains. Phosphorylates the SR splicing factor SRSF1 and the lamin-B receptor (LBR) in vitro. Required for normal muscle development.
  • Tissue specificity
    Exclusively expressed in skeletal and heart muscle.
  • Sequence similarities
    Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family.
    Contains 1 protein kinase domain.
  • Information by UniProt

Images

  • ab162014 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162014 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162014.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up