Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      PLMQVELPISLLTRLALMDPTSLNQFVNTVSASPRTIVSFLSVALLSDQP LLTSDLLSLLAHTARVLSPSHLSFIQELLAGSDESYRPLRSLLGHPENSV RAHTYRLLGHLLQHSMALRGALQSQSGLLSLLLLGLGDKDPVVRCSASFA VGNAAYQAGPLGPALAAAVPSMTQLLGDPQAGIRRNVASALGNLGPEGLG EELLQCEVPQRLLEMACGDPQPNVKEAALIALRSLQQEPGIHQVLVSLGA SEKLSLLSLGNQSLPHSSPRPASAKHCRKLIHLLRPAHSM
    • Amino acids

      1026 to 1315
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162096 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • FU
    • Fused homolog
    • KIAA1278
    • Serine/threonine kinase 36, fused homolog
    • Serine/threonine protein kinase 36 fused homolog
    • Serine/threonine-protein kinase 36
    • STK36
    • STK36_HUMAN
    see all
  • Information by UniProt

Images

  • ab162096 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162096 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162096.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up