Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MSFLTNDASSESIASFSKQEVMSSFLPEGGCYELLTVIGKGFEDLMTVNL ARYKPTGEYVTVRRINLEACSNEMVTFLQGELHVSKLFNHPNIVPYRATF IADNELWVVTSFMAYGSAKDLICTHFMDGMNELAIAYILQGVLKALDYIH HMGYVHRSVKASHILISVDGKVYLSGLRSNLSMISHGQRQRVVHDFPKYS VKVLPWLSPEVLQQNLQGYDAKSDIYSVGITACELANGHVPFKDMPATQM LLEKLNGTVPCLLDTSTIPAEELTMSPSRSVANSGLSDSLTTSTPRPSNG DSPSHPYHRTFSPHFHHFVEQCLQRNPDARYPCWPGPGLRESRGCSGG
    • Amino acids

      1 to 348
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      This sequence is the full length protein isoform 2 (Q7RTN6-2).

Specifications

Our Abpromise guarantee covers the use of ab164904 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as LYK5

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Protein kinase LYK5
    • Serologically defined breast cancer antigen NY BR 96
    • STE20 related adapter protein
    • STRAD
    • STRAD alpha
    see all
  • Relevance

    Members of the STE-20 like kinase family are known to stimulate MAPK pathways by directly activating MAPKKK. LYK5 is a novel pseudokinase member of this family consisting of a STE-20 like kinase domain but lacks several residues that are required for its catalytic activity. It specifically binds LKB1 and plays a key role in regulating the tumor suppressor activities of LKB1. It functions as an upstream activator of LKB1 and also directs the sub-cellular localization of LKB1 by anchoring it in the cytoplasm. LYK5-LKB1 interaction results in phosphorylation of LYK5 and enhanced autophosphorylation of LKB1.
  • Cellular localization

    Cytoplasmic and Nuclear

Images

  • ab164904 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164904 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164904.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up