Description

  • Product name

    Recombinant Human STUB1/CHIP protein
    See all STUB1/CHIP proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MKGKEEKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYG RAITRNPLVA VYYTNRALCYLKMQQHEQALADCRRALELDGQSVKAHF FLGQCQLEMESYDEAIANLQRA YSLAKEQRLNFGDDIPSALRIAKKKR WNSIEERRIHQESELHSYLSRLIAAERERELEEC QRNHEGDEDDSHVR AQQACIEAKHDKYMADMDELFSQVDEKRKKRDIPDYLCGKISFELM RE PCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDA FISENGWV EDY
    • Predicted molecular weight

      37 kDa
    • Amino acids

      1 to 303
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab139765 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Previously labelled as STUB1.  

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.00
    Preservative: 1.02% Imidazole
    Constituents: 0.002% PMSF, 0.82% Sodium phosphate, 0.004% DTT, 20% Glycerol, 1.75% Sodium chloride

General Info

  • Alternative names

    • Antigen NY CO 7
    • Antigen NY-CO-7
    • C terminus of Hsp70-interacting protein
    • Carboxy terminus of Hsp70 interacting protein
    • Carboxy terminus of Hsp70-interacting protein
    • Carboxy terminus of Hsp70p interacting protein
    • CHIP
    • CHIP_HUMAN
    • CLL associated antigen KW 8
    • CLL-associated antigen KW-8
    • E3 ubiquitin protein ligase CHIP
    • E3 ubiquitin-protein ligase CHIP
    • Heat shock protein A binding protein 2 (c terminal)
    • HSPABP2
    • NY CO 7
    • PP1131
    • SDCCAG7
    • Serologically defined colon cancer antigen 7
    • STIP1 homology and U Box containing protein 1
    • STIP1 homology and U box containing protein 1 E3 ubiquitin protein ligase
    • STIP1 homology and U box-containing protein 1
    • STUB 1
    • STUB1
    • UBOX 1
    • UBOX1
    see all
  • Function

    E3 ubiquitin-protein ligase which targets misfolded chaperone substrates towards proteasomal degradation. Ubiquitinates NOS1 in concert with Hsp70 and Hsp40. Modulates the activity of several chaperone complexes, including Hsp70, Hsc70 and Hsp90. Mediates transfer of non-canonical short ubiquitin chains to HSPA8 that have no effect on HSPA8 degradation. Mediates polyubiquitination of DNA polymerase beta (POLB) at 'Lys-41', 'Lys-61' and 'Lys-81', thereby playing a role in base-excision repair: catalyzes polyubiquitination by amplifying the HUWE1/ARF-BP1-dependent monoubiquitination and leading to POLB-degradation by the proteasome. Mediates polyubiquitination of CYP3A4.
  • Tissue specificity

    Highly expressed in skeletal muscle, heart, pancreas, brain and placenta. Detected in kidney, liver and lung.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Contains 3 TPR repeats.
    Contains 1 U-box domain.
  • Domain

    The TPR domain is essential for ubiquitination mediated by UBE2D1.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
    Auto-ubiquitinated; mediated by UBE2D1 and UBE2D2.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • SDS-PAGE showing ab139765 at approximately 37kDa.

References

ab139765 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab139765.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up