Overview

  • Product name
    Recombinant Human STX10 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LDASAVSATSRYIEEQQATQQLIMDEQDQQLEMVSGSIQVLKHMSGRVGE ELDEQGIMLDAFAQEMDHTQSRMDGVLRKLAKV
    • Amino acids
      137 to 219
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160139 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • hsyn10
    • SYN10
    • syntaxin 10
  • Relevance
    Soluble NSF attachment protein receptors (SNAREs) are membrane components that determine the specificity of the docking and fusion of vesicles to target membranes. Syntaxins are target membrane SNAREs. Syntaxin 10 (STX10) is located within the trans-Golgi network (TGN). STX10 may function to receive vesicles either from the Golgi stack or from the endosome. STX10 has a high homology to syntaxin 6. There are 2 isoforms produced by alternative splicing.
  • Cellular localization
    Golgi Apparatus, membrane.

Images

  • ab160139 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160139 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160139.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up