Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MAAAAAGTATSQRFFQSFSDALIDEDPQAALEELTKALEQKPDDAQYYCQ RAYCHILLGNYCVAVADARKSLELNPNNSTAMLRKGICEYHEKNYAAALE TFTEGQKLDSADANFSVWIKRCQEAQNGSESEVWTHQSKIKYGWYQTESQ VVITLMIKNVQKNDVNVEFSEKELSALVKLPSGEDYNLKLELLHPIIPEQ STFKVLSTKIEIKLKKPEAVRWEKLEGQGDVPTPKQFVADVKNLYPSSSP YTRNWDKLVGEIKEEEKNEKLEGDAALNRLFQQIYSDGSDEVKRAMNKSF MESGGTVLSTNWSDVGKRKVEINPPDDMEWKKY
    • Molecular weight

      62 kDa including tags
    • Amino acids

      1 to 333

Specifications

Our Abpromise guarantee covers the use of ab132377 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Protein 40 6 3
    • Protein 40-6-3
    • Protein SGT1 homolog
    • Putative 40 6 3 protein
    • Sgt1
    • SGT1 suppressor of G2 allele of SKP1
    • SGT1_HUMAN
    • SGT1B protein
    • sugt1
    • Suppressor of G2 allele of SKP1 homolog
    • Suppressor of G2 allele of SKP1 S. cerevisiae homolog of
    see all
  • Function

    May play a role in ubiquitination and subsequent proteasomal degradation of target proteins.
  • Sequence similarities

    Belongs to the SGT1 family.
    Contains 1 CS domain.
    Contains 1 SGS domain.
    Contains 3 TPR repeats.
  • Domain

    The CS domain mediates interaction with HSP90.
  • Post-translational
    modifications

    Phosphorylated at Ser-281 and Ser-331, dephosphorylation promotes nuclear translocation, most likely due to disruption of the SUGT1-HSP90 complex.
  • Cellular localization

    Cytoplasm. Nucleus. Translocates to the nucleus upon heat shock, requiring S100A6.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132377 stained with Coomassie Blue.

References

ab132377 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132377.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up