Description

  • Product name

    Recombinant Human SUGT1 protein
    See all SUGT1 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    This protein was expressed in E. coli as inclusion bodies, refolded using unique “temperature shift inclusion body refolding” technology and chromatographically purified.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASMTGGQENGRGEFAAAAAGTATSQRFFQSFSDALIDEDPQAALEELTK ALEQKPDDAQYYCQRAYCHILLGNYCVAVADAKKSLELNPNNSTAMLRKG ICEYHEKNYAAALETFTEGQKLDSADANFSVWIKRCQEAQNGSESEVWTH QSKIKYDWYQTESQVVITLMIKNVQKNDVNVEFSEKELSALVKLPSGEDY NLKLELLHPIIPEQSTFKVLSTKIEIKLKKPEAVRWEKLEGQGDVPTPKQ FVADVKNLYPSSSPYTRNWDKLVGEIKEEEKNEKLEGDAALNRLFQQIYS DGSDEVKRAMNKSFMESGGTVLSTNWSDVGKRKVEINPPDDMEWKKY
    • Predicted molecular weight

      39 kDa including tags
    • Amino acids

      2 to 333
    • Tags

      T7 tag N-Terminus
    • Additional sequence information

      15aa (T7) tag.

Specifications

Our Abpromise guarantee covers the use of ab211951 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -80°C.

    pH: 8.00
    Constituent: 0.32% Tris HCl

    Contains NaCl, KCl, EDTA, Sucrose and DTT.

General Info

  • Alternative names

    • Protein 40 6 3
    • Protein 40-6-3
    • Protein SGT1 homolog
    • Putative 40 6 3 protein
    • Sgt1
    • SGT1 suppressor of G2 allele of SKP1
    • SGT1_HUMAN
    • SGT1B protein
    • sugt1
    • Suppressor of G2 allele of SKP1 homolog
    • Suppressor of G2 allele of SKP1 S. cerevisiae homolog of
    see all
  • Function

    May play a role in ubiquitination and subsequent proteasomal degradation of target proteins.
  • Sequence similarities

    Belongs to the SGT1 family.
    Contains 1 CS domain.
    Contains 1 SGS domain.
    Contains 3 TPR repeats.
  • Domain

    The CS domain mediates interaction with HSP90.
  • Post-translational
    modifications

    Phosphorylated at Ser-281 and Ser-331, dephosphorylation promotes nuclear translocation, most likely due to disruption of the SUGT1-HSP90 complex.
  • Cellular localization

    Cytoplasm. Nucleus. Translocates to the nucleus upon heat shock, requiring S100A6.
  • Information by UniProt

References

ab211951 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab211951.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up