Overview

  • Product name

    Recombinant Human Sulfite oxidase protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSESTHIYTKEEVSSHTSPETGIWVTLGS EVFDVTEFVDLHPGGPSKLMLAAGGPLEPFWALYAVHNQSHVRELLAQYK IGELNPEDKVAPTVETSDPYADDPVRHPALKVNSQRPFNAEPPPELLTEN YITPNPIFFTRNHLPVPNLDPDTYRLHVVGAPGGQSLSLSLDDLHNFPRY EITVTLQCAGNRRSEMTQVKEVKGLEWRTGAISTARWAGARLCDVLAQAG HQLCETEAHVCFEGLDSDPTGTAYGASIPLARAMDPEAEVLLAYEMNGQP LPRDHGFPVRVVVPGVVGARHVKWLGRVSVQPEESYSHWQRRDYKGFSPS VDWETVDFDSAPSIQELPVQSAITEPRDGETVESGEVTIKGYAWSGGGRA VIRVDVSLDGGLTWQVAKLDGEEQRPRKAWAWRLWQLKAPVPAGQKELNI VCKAVDDGYNVQPDTVAPIWNLRGVLSNAW HRVHVYVSP
    • Molecular weight

      54 kDa including tags
    • Amino acids

      80 to 545
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Mature protein without transit peptide.

Specifications

Our Abpromise guarantee covers the use of ab202605 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.
    ab202605 was purified by using conventional chromatography techniques.
  • Form

    Liquid
  • Additional notes

    Previously labelled as SUOX.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 30% Glycerol, 0.02% DTT, 69% PBS

General Info

  • Alternative names

    • EC 1.8.3.1
    • mitochondrial
    • Sulfite oxidase
    • Sulfite oxidase mitochondrial
    • Sulfite oxidase, mitochondrial precursor
    • Suox
    • SUOX_HUMAN
    see all
  • Pathway

    Energy metabolism; sulfur metabolism.
  • Involvement in disease

    Defects in SUOX are the cause of isolated sulfite oxidase deficiency (ISOD) [MIM:272300]; also known as sulfocysteinuria. ISOD is characterized by neurological abnormalities including multicystic leukoencephalopathy with brain atrophy. Patients often suffer from seizures. Often leads to death at an early age.
  • Sequence similarities

    Contains 1 cytochrome b5 heme-binding domain.
  • Cellular localization

    Mitochondrion intermembrane space.
  • Information by UniProt

Images

  • 15% SDS-PAGE using 3 µg of ab202605.

References

ab202605 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202605.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up