Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MNHKVHHHHHHMELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPD DLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGI PSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSY YHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVL YLFYEDMKENPKREIQKILEFVGHSLPEETVDFVVQHTSFKEMKKNPMTN YTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSL SFRSEL
    • Molecular weight
      36 kDa including tags
    • Amino acids
      1 to 295
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab172852 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Endotoxin level
    1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.00
    Constituents: 0.88% Sodium chloride, 99% Phosphate Buffer

General Info

  • Alternative names
    • Aryl sulfotransferase 1
    • HAST1/HAST2
    • Human aryl sulfotransferase mRNA complete cds
    • MGC131921
    • MGC5163
    • OTTHUMP00000162568
    • OTTHUMP00000162569
    • P PST 1
    • P PST
    • P-PST 1
    • Phenol sulfating phenol sulfotransferase 1
    • Phenol sulfotransferase 1
    • Phenol-sulfating phenol sulfotransferase 1
    • PST
    • ST1A1
    • ST1A1_HUMAN
    • ST1A3
    • STP
    • STP1
    • Sulfotransferase 1A1
    • Sulfotransferase family 1A phenol preferring member 1
    • Sulfotransferase family cytosolic 1A phenol preferring member 1
    • Sulfotransferase phenol preferring 1
    • SULT1A1
    • Thermostable phenol sulfotransferase
    • Thermostable phenol sulfotransferase1
    • Ts-PST
    • TSPST1
    see all
  • Function
    Catalyzes the sulfate conjugation of catecholamines, phenolic drugs and neurotransmitters. Is also responsible for the sulfation and activation of minoxidil. Mediates the metabolic activation of carcinogenic N-hydroxyarylamines to DNA binding products and could so participate as modulating factor of cancer risk.
  • Tissue specificity
    Liver, lung, adrenal, brain, platelets and skin.
  • Sequence similarities
    Belongs to the sulfotransferase 1 family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

References

ab172852 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172852.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up