Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      LSPKDILRKDLKLVHGYPMTCAFASNWEKIEQFHSRPDDIVIATYPKSGT TWVSEIIDMILNDGDIEKCKRGFITEKVPMLEMTLPGLRTSGIEQLEKNP SPRIVKTHLPTDLLPKSFWENNCKMIYLARNAKDVSVSYYHFDLMNNLQP FPGTWEEYLEKFLTGKVAYGSWFTHVKNWWKRKEEHPILFLYYEDMKENP KEEIKKIIRFLEKNLNDEILDRIIHHTSFEVMKDNPLVNYTHLPTTVMDH SKSPFMRKGTAGDWKNYFTVAQNEKFDAIYETEMSKTALQFRTEI
    • Molecular weight

      36 kDa including tags
    • Amino acids

      2 to 296
    • Tags

      His tag N-Terminus
    • Additional sequence information

      AAH10895.

Specifications

Our Abpromise guarantee covers the use of ab221408 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.87% Sodium chloride, 5% Trehalose, 0.61% Tris

    Lyophilized from 0.22 µm filtered solution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • Dopa/tyrosine sulfotransferase
    • MGC13356
    • ST1B1
    • ST1B1_HUMAN
    • ST1B2
    • Sulfotransferase 1B1
    • Sulfotransferase 1B2
    • Sulfotransferase family 1B member 1
    • Sulfotransferase family cytosolic 1B member 1
    • SULT1B1
    • SULT1B2
    • Thyroid hormone sulfotransferase
    see all
  • Function

    Catalyzes the sulfate conjugation of many hormones, neurotransmitters, drugs and xenobiotic compounds. Sulfonation increases the water solubility of most compounds, and therefore their renal excretion, but it can also result in bioactivation to form active metabolites. Sulfates dopamine, small phenols such as 1-naphthol and p-nitrophenol and thyroid hormones, including 3,3'-diiodothyronine, triidothyronine, reverse triiodothyronine and thyroxine.
  • Tissue specificity

    Highly expressed in the liver, peripheral blood leukocytes, colon (mucosal lining), small intestine (jejunum) and spleen. A lesser expression was observed in the lung, placenta and thymus.
  • Sequence similarities

    Belongs to the sulfotransferase 1 family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • SDS-PAGE analysis of DTT-reduced ab221408 stained overnight with Coomassie Blue.

    DTT-reduced protein migrates as 35.8 kDa in SDS-PAGE.

References

ab221408 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221408.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up