Description

  • Product name

    Recombinant Human SULT1C2 protein
  • Purity

    > 90 % SDS-PAGE.
    purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMALTSDLGKQIKLKEVEGTLLQPATVDNWS QIQSFEAKPDDLLICTYPKAGTTWIQEIVDMIEQNGDVEKCQRAIIQHRH PFIEWARPPQPSGVEKAKAMPSPRILKTHLSTQLLPPSFWENNCKFLYVA RNAKDCMVSYYHFQRMNHMLPDPGTWEEYFETFINGKVVWGSWFDHVKGW WEMKDRHQILFLFYEDIKRDPKHEIRKVMQFMGKKVDETVLDKIVQETSF EKMKENPMTNRSTVSKSILDQSISSFMRKGTVGDWKNHFTVAQNERFDEI YRRKMEGTSINFCMEL
    • Predicted molecular weight

      37 kDa including tags
    • Amino acids

      1 to 296
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab102759 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.0154% DTT, 0.316% Tris HCl, 20% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • humSULTC2
    • ST1C1
    • ST1C2
    • ST1C2_HUMAN
    • Sulfotransferase 1C1
    • Sulfotransferase 1C2
    • Sulfotransferase family cytosolic 1C member 1
    • Sulfotransferase family cytosolic 1C member 2
    • SULT1C#1
    • SULT1C1
    • SULT1C2
    see all
  • Function

    Catalyzes the sulfate conjugation of many drugs, xenobiotic compounds, hormones, and neurotransmitters. May be involved in the activation of carcinogenic hyroxylamines. Shows activity towards p-nitrophenol and N-hydroxy-2-acetylamino-fluorene (N-OH-2AAF).
  • Tissue specificity

    Found in adult stomach, kidney and thyroid gland, and in fetal kidney and liver.
  • Sequence similarities

    Belongs to the sulfotransferase 1 family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab102759 at approximately 37.0kDa (3µg).

References

ab102759 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab102759.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up