Description

  • Product name

    Recombinant Human SULT2A1/ST2 protein
    See all SULT2A1/ST2 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab108128 was purified using conventional chromatography.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMSDDFLWFEGIAFPTMGFRSETLRKVRDEF VIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVES EIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSG YFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFL LLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSN YSLLSVDYVVDKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRE LFPWE
    • Predicted molecular weight

      36 kDa including tags
    • Amino acids

      1 to 285
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab108128 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Additional notes

     This product was previously labelled as SULT2A1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.0154% DTT, 0.316% Tris HCl, 20% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • Alcohol/hydroxysteroid sulfotransferase
    • Bile salt sulfotranasferase 2A1
    • Bile salt sulfotransferase
    • Dehydroepiandrosterone sulfotransferase
    • DHEA ST
    • DHEA sulfotranasferase
    • DHEA-ST
    • DHEAS
    • EC 2.8.2.14
    • Hst
    • hSTa
    • Hydroxysteroid sulfotransferase
    • ST2
    • ST2A1
    • ST2A1_HUMAN
    • ST2A3
    • STD
    • sulfotranasferase, dehydroepiandrosterone-preferring
    • Sulfotransferase 2A1
    • Sulfotransferase family 2A, dehydroepiandrosterone-preferring, member 1
    • Sulfotransferase family cytosolic 2A dehydroepiandrosterone (DHEA) preferring member 1
    • Sult2a1
    see all
  • Function

    Catalyzes the sulfation of steroids and bile acids in the liver and adrenal glands.
  • Tissue specificity

    Liver, adrenal and at lower level in the kidney. Is present in human fetus in higher level in the adrenal than the liver and the kidney.
  • Sequence similarities

    Belongs to the sulfotransferase 1 family.
  • Post-translational
    modifications

    The N-terminus is blocked.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab108128.

References

ab108128 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab108128.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up