Description

  • Product name

    Recombinant Human SULT2B1 protein
    See all SULT2B1 proteins and peptides
  • Purity

    > 80 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MDGPAEPQIPGLWDTYEDDISEISQKLPGEYFRYKGVPFPVGLYSLESIS LAENTQDVRDDDIFIITYPKSGTTWMIEIICLILKEGDPSWIRSVPIWER APWCETIVGAFSLPDQYSPRLMSSHLPIQIFTKAFFSSKAKVIYMGRNPR DVVVSLYHYSKIAGQLKDPGTPDQFLRDFLKGEVQFGSWFDHIKGWLRMK GKDNFLFITYEELQQDLQGSVERICGFLGRPLGKEALGSVVAHSTFSAMK ANTMSNYTLLPPSLLDHRRGAFLRKGVCGDWKNHFTVAQSEAFDRAYRKQ MRGMPTFPWDEDPEEDGSPDPEPSPEPEPKPSLEPNTSLEREPRPNSSPS PSPGQASETPHPRPS
    • Predicted molecular weight

      42 kDa including tags
    • Amino acids

      1 to 365
    • Tags

      His tag N-Terminus
    • Additional sequence information

      (AAH34694)

Specifications

Our Abpromise guarantee covers the use of ab221228 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.61% Tris, 0.87% Sodium chloride, 5% Trehalose

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 1 mg/mL. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • Alcohol sulfotransferase
    • EC 2.8.2.2
    • HSST2
    • Hydroxysteroid sulfotransferase 2
    • ST2B1
    • ST2B1_HUMAN
    • Sulfotransferase 2B1
    • Sulfotransferase family cytosolic 2B member 1
    • SULT2B1
    • SULT2B1a
    • SULT2B1b
    see all
  • Function

    Catalyzes the sulfate conjugation of many hormones, neurotransmitters, drugs and xenobiotic compounds. Sulfonation increases the water solubility of most compounds, and therefore their renal excretion, but it can also result in bioactivation to form active metabolites. Sulfates hydroxysteroids like DHEA. Isoform 1 preferentially sulfonates cholesterol, and isoform 2 avidly sulfonates pregnenolone but not cholesterol.
  • Tissue specificity

    Expressed highly in placenta, prostate and trachea and lower expression in the small intestine and lung.
  • Sequence similarities

    Belongs to the sulfotransferase 1 family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab221228 stained overnight with Coomassie Blue.

    DTT-reduced protein migrates as 46 kDa.

References

ab221228 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221228.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up