Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MDGPAEPQIPGLWDTYEDDISEISQKLPGEYFRYKGVPFPVGLYSLESIS LAENTQDVRDDDIFIITYPKSGTTWMIEIICLILKEGDPSWIRSVPIWER APWCETIVGAFSLPDQYSPRLMSSHLPIQIFTKAFFSSKAKVIYMGRNPR DVVVSLYHYSKIAGQLKDPGTPDQFLRDFLKGEVQFGSWFDHIKGWLRMK GKDNFLFITYEELQQDLQGSVERICGFLGRPLGKEALGSVVAHSTFSAMK ANTMSNYTLLPPSLLDHRRGAFLRKGVCGDWKNHFTVAQSEAFDRAYRKQ MRGMPTFPWDEVDHHHHHH
    • Molecular weight
      37 kDa including tags
    • Amino acids
      1 to 311
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab173038 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.58% Sodium chloride, 0.03% EDTA, 0.24% Tris

    Supplied as a 0.2 µM filtered solution.

General Info

  • Alternative names
    • Alcohol sulfotransferase
    • EC 2.8.2.2
    • HSST2
    • Hydroxysteroid sulfotransferase 2
    • ST2B1
    • ST2B1_HUMAN
    • Sulfotransferase 2B1
    • Sulfotransferase family cytosolic 2B member 1
    • SULT2B1
    • SULT2B1a
    • SULT2B1b
    see all
  • Function
    Catalyzes the sulfate conjugation of many hormones, neurotransmitters, drugs and xenobiotic compounds. Sulfonation increases the water solubility of most compounds, and therefore their renal excretion, but it can also result in bioactivation to form active metabolites. Sulfates hydroxysteroids like DHEA. Isoform 1 preferentially sulfonates cholesterol, and isoform 2 avidly sulfonates pregnenolone but not cholesterol.
  • Tissue specificity
    Expressed highly in placenta, prostate and trachea and lower expression in the small intestine and lung.
  • Sequence similarities
    Belongs to the sulfotransferase 1 family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

References

ab173038 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab173038.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up