Overview

  • Product name

    Recombinant Human SUMF2 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      QATSMVQLQGGRFLMGTNSPDSRDGEGPVREATVKPFAIDIFPVTNKDFR DFVREKKYRTEAEMFGWSFVFEDFVSDELRNKATQPMKSVLWWLPVEKAF
    • Amino acids

      26 to 125
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161818 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • C alpha formyglycine generating enzyme 2
    • C-alpha-formylglycine-generating enzyme 2
    • DKFZp566I1024
    • DKFZp66I1024
    • DKFZp686L17160
    • DKFZp781L1035
    • MGC99485
    • Paralog of the formylglycine generating enzyme
    • pFGE
    • Sulfatase modifying factor 2
    • Sulfatase-modifying factor 2
    • SUMF 2
    • SUMF2
    • SUMF2_HUMAN
    see all
  • Function

    Lacks formyl-glycine generating activity and is unable to convert newly synthesized inactive sulfatases to their active form. Inhibits the activation of sulfatases by SUMF1.
  • Tissue specificity

    Detected in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Highest levels in kidney, liver and placenta.
  • Sequence similarities

    Belongs to the sulfatase-modifying factor family.
  • Cellular localization

    Endoplasmic reticulum lumen.
  • Information by UniProt

Images

  • ab161818 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161818 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161818.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up