Recombinant Human Sumo 1 protein (ab140417)
Key features and details
- Expression system: Escherichia coli
- Purity: > 90% Densitometry
- Tags: His tag N-Terminus
- Suitable for: WB, SDS-PAGE
Description
-
Product name
Recombinant Human Sumo 1 protein
See all Sumo 1 proteins and peptides -
Purity
> 90 % Densitometry. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
SDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESY CQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG -
Predicted molecular weight
19 kDa including tags -
Amino acids
2 to 97 -
Tags
His tag N-Terminus
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab140417 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Western blot
SDS-PAGE
-
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 7.00
Preservative: 1.02% Imidazole
Constituents: 0.002% PMSF, 0.82% Sodium phosphate, 0.004% DTT, 25% Glycerol (glycerin, glycerine), 1.75% Sodium chloride
General Info
-
Alternative names
- DAP1
- GAP modifying protein 1
- GAP-modifying protein 1
see all -
Function
Ubiquitin-like protein that can be covalently attached to proteins as a monomer or a lysine-linked polymer. Covalent attachment via an isopeptide bond to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by E3 ligases such as PIAS1-4, RANBP2 or CBX4. This post-translational modification on lysine residues of proteins plays a crucial role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Involved for instance in targeting RANGAP1 to the nuclear pore complex protein RANBP2. Polymeric SUMO1 chains are also susceptible to polyubiquitination which functions as a signal for proteasomal degradation of modified proteins. May also regulate a network of genes involved in palate development. -
Involvement in disease
Defects in SUMO1 are the cause of non-syndromic orofacial cleft type 10 (OFC10) [MIM:613705]; also called non-syndromic cleft lip with or without cleft palate 10. OFC10 is a birth defect consisting of cleft lips with or without cleft palate. Cleft lips are associated with cleft palate in two-third of cases. A cleft lip can occur on one or both sides and range in severity from a simple notch in the upper lip to a complete opening in the lip extending into the floor of the nostril and involving the upper gum. Note=A chromosomal aberation involving SUMO1 is the cause of OFC10. Translocation t(2;8)(q33.1;q24.3). The breakpoint occurred in the SUMO1 gene and resulted in haploinsufficiency confirmed by protein assays. -
Sequence similarities
Belongs to the ubiquitin family. SUMO subfamily.
Contains 1 ubiquitin-like domain. -
Post-translational
modificationsCleavage of precursor form by SENP1 or SENP2 is necessary for function.
Polymeric SUMO1 chains undergo polyubiquitination by RNF4. -
Cellular localization
Nucleus membrane. Nucleus speckle. Cytoplasm. Recruited by BCL11A into the nuclear body. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab140417 has not yet been referenced specifically in any publications.