Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCER QGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG
    • Molecular weight

      18 kDa including tags
    • Amino acids

      1 to 93
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab140420 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

  • Purity

    > 95 % Densitometry.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 0.70
    Preservative: 1.02% Imidazole
    Constituents: 0.002% PMSF, 0.71% Sodium phosphate, 0.004% DTT, 25% Glycerol, 1.75% Sodium chloride

General Info

  • Alternative names

    • HSMT 3
    • HSMT3
    • MGC117191
    • Sentrin 2
    • Sentrin-2
    • Sentrin2
    • Small ubiquitin like modifier 2
    • Small ubiquitin related modifier 2
    • Small ubiquitin-related modifier 2
    • SMT 3B
    • SMT3 homolog 2
    • SMT3 suppressor of mif two 3 homolog 2
    • SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae)
    • SMT3, yeast, homolog 2
    • Smt3A
    • SMT3B
    • SMT3H2
    • SUMO-2
    • SUMO-3
    • SUMO2
    • SUMO2_HUMAN
    • Sumo3
    • Ubiquitin like protein SMT3B
    • Ubiquitin-like protein SMT3A
    see all
  • Function

    Ubiquitin-like protein that can be covalently attached to proteins as a monomer or as a lysine-linked polymer. Covalent attachment via an isopeptide bond to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by an E3 ligase such as PIAS1-4, RANBP2 or CBX4. This post-translational modification on lysine residues of proteins plays a crucial role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Polymeric SUMO2 chains are also susceptible to polyubiquitination which functions as a signal for proteasomal degradation of modified proteins.
  • Tissue specificity

    Broadly expressed.
  • Sequence similarities

    Belongs to the ubiquitin family. SUMO subfamily.
    Contains 1 ubiquitin-like domain.
  • Post-translational
    modifications

    Polymeric chains can be formed through Lys-11 cross-linking. Polymeric SUMO2 chains undergo 'Lys-6'-, 'Lys-11'-, 'Lys-48'- and 'Lys-63'-linked polyubiquitination by RNF4.
    Cleavage of precursor form by SENP1 or SENP2 is necessary for function.
  • Cellular localization

    Nucleus. Nuclear bodies.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab140420.

References

ab140420 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab140420.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up