Description

  • Product name

    Recombinant Human Sumo 3 protein
    See all Sumo 3 proteins and peptides
  • Purity

    > 95 % Densitometry.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQ GLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG
    • Predicted molecular weight

      17 kDa including tags
    • Amino acids

      1 to 92
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab140414 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.00
    Preservative: 1.02% Imidazole
    Constituents: 0.002% PMSF, 0.71% Sodium phosphate, 0.004% DTT, 25% Glycerol, 1.75% Sodium chloride

General Info

  • Alternative names

    • Small ubiquitin like modifier 3
    • Small ubiquitin related modifier 3
    • Small ubiquitin-related modifier 3
    • SMT3 homolog 1
    • SMT3 suppressor of mif two 3 homolog 1
    • SMT3 suppressor of mif two 3 homolog 3
    • SMT3, yeast, homolog 1
    • SMT3A
    • Smt3B
    • SMT3H1
    • SUMO-2
    • SUMO-3
    • sumo3
    • SUMO3_HUMAN
    • Ubiquitin like protein SMT3A
    • Ubiquitin-like protein SMT3B
    see all
  • Function

    Ubiquitin-like protein which can be covalently attached to target lysines either as a monomer or as a lysine-linked polymer. Does not seem to be involved in protein degradation and may function as an antagonist of ubiquitin in the degradation process. Plays a role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Covalent attachment to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by an E3 ligase such as PIAS1-4, RANBP2 or CBX4.
  • Tissue specificity

    Expressed predominantly in liver.
  • Sequence similarities

    Belongs to the ubiquitin family. SUMO subfamily.
    Contains 1 ubiquitin-like domain.
  • Post-translational
    modifications

    Polymeric chains can be formed through Lys-11 cross-linking.
    Cleavage of precursor form by SENP1, SENP2 or SENP5 is necessary for function.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab140414.

References

ab140414 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab140414.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up