Recombinant Human Sumo 3 protein (ab159550)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQ GLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAG HSF
    • Amino acids
      1 to 103
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159550 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Small ubiquitin like modifier 3
    • Small ubiquitin related modifier 3
    • Small ubiquitin-related modifier 3
    • SMT3 homolog 1
    • SMT3 suppressor of mif two 3 homolog 1
    • SMT3 suppressor of mif two 3 homolog 3
    • SMT3, yeast, homolog 1
    • SMT3A
    • Smt3B
    • SMT3H1
    • SUMO-2
    • SUMO-3
    • sumo3
    • SUMO3_HUMAN
    • Ubiquitin like protein SMT3A
    • Ubiquitin-like protein SMT3B
    see all
  • Function
    Ubiquitin-like protein which can be covalently attached to target lysines either as a monomer or as a lysine-linked polymer. Does not seem to be involved in protein degradation and may function as an antagonist of ubiquitin in the degradation process. Plays a role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Covalent attachment to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by an E3 ligase such as PIAS1-4, RANBP2 or CBX4.
  • Tissue specificity
    Expressed predominantly in liver.
  • Sequence similarities
    Belongs to the ubiquitin family. SUMO subfamily.
    Contains 1 ubiquitin-like domain.
  • Post-translational
    modifications
    Polymeric chains can be formed through Lys-11 cross-linking.
    Cleavage of precursor form by SENP1, SENP2 or SENP5 is necessary for function.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab159550 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159550 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159550.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up