Description

  • Product name

    Recombinant Human SUN2 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSRRSQRLTRYSQGDDDGSSSSGGSSVAGSQSTLFKDSPLRTLKRKSSNM KRLSPAPQLGPSSDAHTSYYSESLVHESWFPPRSSLEELHGDANWGEDLR VRRRRGTGGSESSRASGLVGRKATEDFLGSSSGYSSEDDYVGYSDVDQQS SSSRLRSAVSRAGSLLWMVATSPGRLFRLLYWWAGTTWYRLTTAASLLDV FVLTRRFSSLKTFLWFLLPLLLLTCLTYGAWYFYPYGLQTFHPALVSWWA AKDSRRPDEGWEARDSSPHFQAEQRVMSRVHSLERRLEALAAEFSSNWQK EAMRLERLELRQGAPGQGGGGGLSHEDTLALLEGLVSRREAALKEDFRRE TAARIQEELSALRAEHQQDSEDLFKKIVRASQESEARIQQLKSEWQSMTQ ESFQESSVKELRRLEDQLAGLQQELAALALKQSSVAEEVGLLPQQIQAVR DDVESQFPAWISQFLARGGGGRVGLLQREEMQAQLRELESKILTHVAEMQ GKSAREAAASLSLTLQKEGVIGVTEEQVHHIVKQALQRYSEDRIGLADYA LESGGASVISTRCSETYETKTALLSLFGIPLWYHSQSPRVILQPDVHPGN CWAFQGPQGFAVVRLSARIRPTAVTLEHVPKALSPNSTISSAPKDFAIFG FDEDLQQEGTLLGKFTYDQDGEPIQTFHFQAPTMATYQVVELRILTNWGH PEYTCIYRFRVHGEPAH
    • Predicted molecular weight

      105 kDa including tags
    • Amino acids

      1 to 717

Specifications

Our Abpromise guarantee covers the use of ab132707 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • FRIGG
    • KIAA0668
    • nuclear envelope protein
    • Protein unc-84 homolog B
    • Rab5 interacting protein
    • RAB5IP
    • Sad1 and UNC84 domain containing 2
    • Sad1 unc-84 domain protein 2
    • Sad1 unc84 domain protein
    • Sad1/unc-84 protein-like 2
    • Sad1/unc84 protein-like
    • SUN domain-containing protein 2
    • UNC 84B
    • unc84 homolog B
    • unc84 homolog B (C. elegans)
    • unc84, C. elegans, homolog of, B
    • UNC84B
    see all
  • Relevance

    SUN proteins form part of the LINC complex - a protein bridge that spans the nuclear envelope linking the nucleoskeleten to the actin cytoskeleten. They are located on the inner nuclear membrane side of the complex. The LINC complex is thought to function in controlling nuclear position, contributing to mechanical resistance and the overall architecture of the cell. SUN2 can exist in a heterodimer with SUN1. Both can interact with lamins and nesprins in the nuclear envelope.
  • Cellular localization

    Nuclear membrane, endosome membrane, mitotic spindle organization.

Images

  • ab132707 analyzed by 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab132707 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132707.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up