Description

  • Product name

    Recombinant Human Superoxide Dismutase 3/EC-SOD protein
    See all Superoxide Dismutase 3/EC-SOD proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      WTGEDSAEPNSDSAEWIRDMYAKVTEIWQEVMQRRDDDGALHAACQVQPS ATLDAAQPRVTGVVLFRQLAPRAKLDAFFALEGFPTEPNSSSRAIHVHQF GDLSQGCESTGPHYNPLAVPHPQHPGDFGNFAVRDGSLWRYRAGLAASLA GPHSIVGRAVVVHAGEDDLGRGGNQASVENGNAGRRLACCVVGVCGPGLW ERQAREHSERKKRRRESECKAA
    • Predicted molecular weight

      24 kDa
    • Amino acids

      19 to 240
    • Additional sequence information

      Full-length mature chain lacking the signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab236186 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Previously labelled as Superoxide Dismutase 3.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • EC SOD
    • EC-SOD
    • Extracellular superoxide dismutase
    • Extracellular superoxide dismutase [Cu Zn]
    • Extracellular superoxide dismutase [Cu-Zn]
    • Extracellular superoxide dismutase precursor
    • MGC20077
    • SOD 3
    • SOD3
    • SODE_HUMAN
    • Superoxide Dismutase 3
    • Superoxide dismutase 3 extracellular
    see all
  • Function

    Protect the extracellular space from toxic effect of reactive oxygen intermediates by converting superoxide radicals into hydrogen peroxide and oxygen.
  • Tissue specificity

    Expressed in blood vessels, heart, lung, kidney and placenta. Major SOD isoenzyme in extracellular fluids such as plasma, lymph and synovial fluid.
  • Sequence similarities

    Belongs to the Cu-Zn superoxide dismutase family.
  • Cellular localization

    Secreted > extracellular space. 99% of EC-SOD is anchored to heparan sulfate proteoglycans in the tissue interstitium, and 1% is located in the vasculature in equilibrium between the plasma and the endothelium.
  • Information by UniProt

Images

  • ab236186 analyzed by (Tris-Glycine gel) discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

References

ab236186 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236186.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up