Recombinant Human Superoxide Dismutase 3/EC-SOD protein (His tag) (ab236182)

Description

  • Product name

    Recombinant Human Superoxide Dismutase 3/EC-SOD protein (His tag)
    See all Superoxide Dismutase 3/EC-SOD proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      WTGEDSAEPNSDSAEWIRDMYAKVTEIWQEVMQRRDDDGALHAACQVQPS ATLDAAQPRVTGVVLFRQLAPRAKLDAFFALEGFPTEPNSSSRAIHVHQF GDLSQGCESTGPHYNPLAVPHPQHPGDFGNFAVRDGSLWRYRAGLAASLA GPHSIVGRAVVVHAGEDDLGRGGNQASVENGNAGRRLACCVVGVCGPGLW ERQAREHSERKKRRRESECKAA
    • Predicted molecular weight

      28 kDa including tags
    • Amino acids

      19 to 240
    • Tags

      His tag N-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 19 to 240. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab236182 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Previously labelled as Superoxide Dismutase 3.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • EC SOD
    • EC-SOD
    • Extracellular superoxide dismutase
    • Extracellular superoxide dismutase [Cu Zn]
    • Extracellular superoxide dismutase [Cu-Zn]
    • Extracellular superoxide dismutase precursor
    • MGC20077
    • SOD 3
    • SOD3
    • SODE_HUMAN
    • Superoxide Dismutase 3
    • Superoxide dismutase 3 extracellular
    see all
  • Function

    Protect the extracellular space from toxic effect of reactive oxygen intermediates by converting superoxide radicals into hydrogen peroxide and oxygen.
  • Tissue specificity

    Expressed in blood vessels, heart, lung, kidney and placenta. Major SOD isoenzyme in extracellular fluids such as plasma, lymph and synovial fluid.
  • Sequence similarities

    Belongs to the Cu-Zn superoxide dismutase family.
  • Cellular localization

    Secreted > extracellular space. 99% of EC-SOD is anchored to heparan sulfate proteoglycans in the tissue interstitium, and 1% is located in the vasculature in equilibrium between the plasma and the endothelium.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab236182.

References

ab236182 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236182.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up