Overview

  • Product name
    Recombinant Human Supervillin protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LIHAGLEPLTFTNMFPSWEHREDIAEITEMDTEVSNQITLVEDVLAKLCK TIYPLADLLARPLPEGVDPLKLEIYLTDEDFEFALDMTRDEYNALPAWKQ VNLKKAKG
    • Amino acids
      1679 to 1786
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159621 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Archvillin
    • p205/p250
  • Relevance
    Supervillin is an F-actin-binding protein originally with two reported isoforms of 205/250 kDa. The longer isoform, named archvillin, is muscle-specific. Supervillin is a tightly bound peripheral membrane protein that is concentrated at sites of epithelial cell-cell adhesion. It contributes to cell-cell adhesion, motility regulation, and information transfer between cell compartments. The COOH-terminus of supervillin is homologous to villin/gelsolin but is not responsible for the tight binding to the actin cytoskeleton in vivo. The NH2-terminus contains functional nuclear localization sequences and F-actin and myosin II binding domains. It has been suggested that supervillin may mediate actin and myosin II filament organization at cholesterol-rich membrane domains. Supervillin has been identified as a transcriptional activator of the androgen receptor. Supervillin is found in many cells of several species, but is most abundant in muscle, bone marrow, thyroid gland, and salivary gland.
  • Cellular localization
    Cell membrane; peripheral membrane protein; cytoplasmic side. Cytoplasm; cytoskeleton.

Images

  • ab159621 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159621 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159621.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up