Description

  • Product name

    Recombinant Human Surfactant protein D/SP-D
    See all Surfactant protein D/SP-D proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    The purity of ab152069 is greater than 95%, as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      AGMKTYSHRTMPSACTLVMCSSVESGLPGRDGRDGREGPRGEKGDPGLPG AAGQAGMPGQAGPVGPKGDNGSVGEPGPKGDTGPSGPPGPPGVPGPAGRE GPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSAGARGLAGPKGERGV PGERGVPGNTGAAGSAGAMGPQGSPGARGPPGLKGDKGIPGDKGAKGESG LPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGF VKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKT EGKFTYPTGESLVYSNWAPGKPNDDGGSEDCVEIFTNGKWNDRACGEKRL VVCEFVDHHHHHH
    • Predicted molecular weight

      37 kDa including tags
    • Amino acids

      21 to 375
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152069 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Additional notes

    Previously labelled as Surfactant protein D.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term.

    pH: 7.20
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
    It is not recommended to reconstitute to a concentration less than 100 µg/ml.
    Dissolve the lyophilized protein in 1X PBS.
    Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
    Aliquots of reconstituted samples are stable at < -20°C for 3 months.

General Info

  • Alternative names

    • COLEC 7
    • COLEC7
    • Collectin-7
    • Collectin7
    • Lung surfactant protein D
    • PSP D
    • PSP-D
    • PSP-D Surfactant protein D
    • PSPD
    • Pulmonary surfactant apoprotein
    • Pulmonary surfactant associated protein D
    • Pulmonary surfactant associated protein PSP-D
    • Pulmonary surfactant-associated protein D
    • SFTP 4
    • SFTP4
    • SFTPD
    • SFTPD_HUMAN
    • SP D
    • SP-D
    • Surfactant associated protein pulmonary 4
    • Surfactant protein D
    • Surfactant pulmonary associated protein D
    see all
  • Function

    Contributes to the lung's defense against inhaled microorganisms. May participate in the extracellular reorganization or turnover of pulmonary surfactant. Binds strongly maltose residues and to a lesser extent other alpha-glucosyl moieties.
  • Sequence similarities

    Belongs to the SFTPD family.
    Contains 1 C-type lectin domain.
    Contains 1 collagen-like domain.
  • Post-translational
    modifications

    The N-terminus is blocked.
    Hydroxylation on proline residues within the sequence motif, GXPG, is most likely to be 4-hydroxy as this fits the requirement for 4-hydroxylation in vertebrates.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix. Secreted > extracellular space > surface film.
  • Information by UniProt

References

ab152069 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Answer

Ab152069 has a purity greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
The endotoxin level is less than 0.1 ng/μg (1 IEU/μg) for this product.

After checking with our product department, ab152675's purity is >85% with the current lot, but we have not determined its endotoxin level.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up