Overview

  • Product name
    Recombinant Human SUV3L1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      NLEGFPSGSQSRLSGTLKSQARRTRGTKALGSKATEPPSPDAGELSLASR LVQQGLLTPDMLKQLEKEWMTQQTEHNKEKTESGTHPKGTRRKKKEPDSD
    • Amino acids
      687 to 786
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159614 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 6330443E10Rik
    • ATP dependent RNA helicase SUPV3L1, mitochondrial
    • ATP-dependent RNA helicase SUPV3L1
    • EC 3.6.1.
    • MGC109049
    • mitochondrial
    • OTTHUMP00000019719
    • S. Cerevisiae suppressor of var 1 3 like 1
    • suppressor of var1 (S.cerevisiae) 3 like 1
    • Suppressor of var1 3 like 1
    • Suppressor of var1 3 like 1 (S. cerevisiae)
    • Suppressor of var1 3 like 1 (S. cerevisiae)(SUV3)
    • Suppressor of var1 3 like protein 1
    • Suppressor of var1 3-like protein 1
    • SUPV 3 L 1
    • SUPV3L1
    • SUV 3
    • SUV 3 L 1
    • SUV3
    • SUV3 like protein 1
    • SUV3-like protein 1
    • SUV3_HUMAN
    • SUV3L1
    see all
  • Function
    Major helicase player in mitochondrial RNA metabolism. Component of the mitochondrial degradosome (mtEXO) complex, that degrades 3' overhang double-stranded RNA with a 3'-to-5' directionality in an ATP-dependent manner. ATPase and ATP-dependent multisubstrate helicase, able to unwind double-stranded (ds) DNA and RNA, and RNA/DNA heteroduplexes in the 5'-to-3' direction. Plays a role in the RNA surveillance system in mitochondria; regulates the stability of mature mRNAs, the removal of aberrantly formed mRNAs and the rapid degradation of non coding processing intermediates. Also implicated in recombination and chromatin maintenance pathways. May protect cells from apoptosis. Associates with mitochondrial DNA.
  • Tissue specificity
    Broadly expressed.
  • Sequence similarities
    Belongs to the helicase family.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
  • Cellular localization
    Nucleus. Mitochondrion matrix. Mitochondrion matrix > mitochondrion nucleoid.
  • Information by UniProt

Images

  • ab159614 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159614 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159614.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up