Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      HLQAVDYASRTKVFPGERVGHVTFNFTLENQIHRGGQYFNDKFIGLRLKS VSFEDSL
    • Amino acids

      474 to 530
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153025 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • KIAA0736
    • OTTHUMP00000014065
    • SV2
    • Sv2a
    • SV2A_HUMAN
    • Synaptic vesicle glycoprotein 2
    • Synaptic vesicle glycoprotein 2A
    • Synaptic vesicle protein 2a
    see all
  • Function

    Plays a role in the control of regulated secretion in neural and endocrine cells, enhancing selectively low-frequency neurotransmission. Positively regulates vesicle fusion by maintaining the readily releasable pool of secretory vesicles.
  • Sequence similarities

    Belongs to the major facilitator superfamily.
  • Post-translational
    modifications

    Phosphorylation by CK1 of the N-terminal cytoplasmic domain regulates interaction with SYT1.
    N-glycosylated.
  • Cellular localization

    Cytoplasmic vesicle > secretory vesicle > synaptic vesicle membrane. Enriched in chromaffin granules, not present in adrenal microsomes. Associated with both insulin granules and synaptic-like microvesicles in insulin-secreting cells of the pancreas.
  • Information by UniProt

Images

  • ab153025 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153025 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153025.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up