Recombinant Human SWSAP1 protein (ab199587)

Overview

  • Product name

    Recombinant Human SWSAP1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MNHKVHHHHHHMPAAGPPLLLLGTPGSGKTALLFAAALEAAGEGQGPVLF LTRRPLQSMPRGTGTTLDPMRLQKIRFQYPPSTRELFRLLCSAHEAPGPA PSLLLLDGLEEYLAEDPEPQEAAYLIALLLDTAAHFSHRLGPGRDCGLMV ALQTQEEAGSGDVLHLALLQRYFPAQCWLQPDAPGPGEHGLRACLEPGGL GPRTEWWVTFRSDGEMMIAPWPTQAGDPSSGKGSSSGGQP
    • Molecular weight

      26 kDa including tags
    • Amino acids

      1 to 229
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab199587 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    Purity greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

  • Reconstitution
    'Lyophilized from a 0.2 µM filtered solution of PBS,pH 7.4 Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
    It is not recommended to reconstitute to a concentration less than 100 µg/ml.
    Dissolve the lyophilized protein in 1X PBS.
    Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

General Info

  • Alternative names

    • ATPase SWSAP1
    • C19orf39
    • SWAP1_HUMAN
    • SWIM-type zinc finger 7-associated protein 1
    • SWS1-associated protein 1
    • SWS1AP1
    • SWSAP1
    • Zinc finger SWIM type containing 7 associated protein 1
    • ZSWIM7-associated protein 1
    • ZSWIM7AP1
    see all
  • Function

    ATPase which is preferentially stimulated by single-stranded DNA and is involved in homologous recombination repair (HRR). Has a DNA-binding activity which is independent of its ATPase activity.
  • Cellular localization

    Nucleus.
  • Information by UniProt

References

ab199587 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab199587.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up