Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MAILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNY LFHYICQDRIVYLCITDDDFERSRAFNFLNEIKKRFQTTYGSRAQTALPY AMNSEFSSVLAAQLKHHSENKGLDKVMETQAQVDELKGIMVRNIDLVAQR GERLELLIDKTENLVDSSVTFKTTSRNLARAMCMKNLKLTIIIIIVSIVF IYIIVSPLCGGFTWPSCVKK
    • Molecular weight

      51 kDa including tags
    • Amino acids

      1 to 220

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132421 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.

    Previously labelled as SYBL1. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • FLJ53045
    • FLJ53762
    • FLJ54296
    • HGNC:11486
    • OTTHUMP00000024258
    • OTTHUMP00000024259
    • OTTHUMP00000225953
    • SYBL 1
    • SYBL1
    • Synaptobrevin like 1
    • Synaptobrevin-like protein 1
    • Tetanus insensitive VAMP
    • Tetanus neurotoxin insensitive VAMP
    • Tetanus-insensitive VAMP
    • TI VAMP
    • Ti-VAMP
    • TIVAMP
    • VAMP-7
    • VAMP7
    • VAMP7_HUMAN
    • Vesicle-associated membrane protein 7
    see all
  • Function

    Involved in the targeting and/or fusion of transport vesicles to their target membrane during transport of proteins from the early endosome to the lysosome. Required for heterotypic fusion of late endosomes with lysosomes and homotypic lysosomal fusion. Required for calcium regulated lysosomal exocytosis. Involved in the export of chylomicrons from the endoplasmic reticulum to the cis Golgi. Required for exocytosis of mediators during eosinophil and neutrophil degranulation, and target cell killing by natural killer cells. Required for focal exocytosis of late endocytic vesicles during phagosome formation.
  • Tissue specificity

    Detected in all tissues tested.
  • Sequence similarities

    Belongs to the synaptobrevin family.
    Contains 1 longin domain.
    Contains 1 v-SNARE coiled-coil homology domain.
  • Cellular localization

    Cytoplasmic vesicle > secretory vesicle membrane. Golgi apparatus > trans-Golgi network membrane. Late endosome membrane. Lysosome membrane. Endoplasmic reticulum membrane. Cytoplasmic vesicle > phagosome membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132421, stained with Coomassie Blue.

References

ab132421 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132421.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up