Overview

  • Product name
    Recombinant Human SYCE1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLQECKERISALNLQIEEEKNKQRQLRLAFEEQLEDLMGQHKDLWDFHMP ERLAKEICALDSSKEQLLKEEKLVKATLEDVKHQLCSLCGAEGPSTLDEG LFLRSQEAAATVQLFQEEHRKAEELLAAAAQRHQQLQQKCQQQQQKRQRL KEELEKHGMQVPAQAQSTQEEEAGPGDVAPRPGRPVTWWS
    • Amino acids
      1 to 190
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164938 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • bA108K14.6
    • C10orf94
    • Cancer/testis antigen 76
    • CT76
    • RP11-108K14.6
    • Syce1
    • SYCE1_HUMAN
    • Synaptonemal complex central element protein 1
    see all
  • Function
    Major component of the transverse central element of synaptonemal complexes (SCS), formed between homologous chromosomes during meiotic prophase. Requires SYCP1 in order to be incorporated into the central element. May have a role in the synaptonemal complexe assembly, stabilization and recombination.
  • Sequence similarities
    Belongs to the SYCE family.
  • Cellular localization
    Nucleus. Chromosome. Associates with chromatin. In prophase I stage of meiosis, localizes in the transverse central elements of the central region between lateral elements of the synaptonemal complexes. Found only where the chromosome cores are synapsed. Colocalizes with SYCE2 in the central elements.
  • Information by UniProt

Images

  • ab164938 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164938 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164938.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up