Overview

  • Product name
    Recombinant Human Symplekin protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MASGSGDSVTRRSVASQFFTQEEGPGIDGMTTSERVVDLLNQAALITNDS KITVLKQVQELIINKDPTLLDNFLDEIIAFQADKSIEVRKFVIGFIEEAC KRDIELLLKLIANLNMLLRDENVNVVKKAILTMTQLYKVALQWMVKSRVI SELQEACWDMVSAMAGDIILLLDSDNDGIRTHAIKFVEGLIVTLSPRMAD SEIPRRQEHDISLDRIPRDHPYIQYNVLWEEGKAALEQLLKFMVHPAISS INLTTALGSLANIARQRPMFMSEVIQAYETLHANLPPTLAKSQVSSVRKN LKLHLLSVLKHPASLEFQAQITTLLVDLGTPQAEIARNMPSSKDTRKRPR DDSDSTLKKMKLEPNLGEDDEDKDLEPGPSGTSKASAQISGQSDTDITAE FLQPLLTPDNVANLVLISMVYLPEAMPASFQAIYTPVESAGTEAQIKHLA RLMATQMTAAGLGPGVEQTKQCKEEPKEEKVVKTESVLIKRRLSAQGQAI SVVGSLSSMSPLEEEAPQAKRRPEPIIPVTQPR
    • Amino acids
      1 to 533
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159958 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ27092
    • SPK
    • SYM
    • SYMPK
  • Relevance
    Symplekin (SYMPK) can associate with tight junctions, functions in the regulation of polyadenylation and promotes gene expression. It is thought to serve as a scaffold for recruiting regulatory factors to the polyadenylation complex. It also participates in 3'-end maturation of histone mRNAs, which do not undergo polyadenylation.
  • Cellular localization
    Cytoplasm, cytoskeleton. Cell junction, tight junction; Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cell junction; Cytoplasmic side. Nucleus, nucleoplasm. Note Cytoplasmic face of adhesion plaques (major) and nucleoplasm (minor) (in cells with TJ). Nucleoplasm (in cells without TJ). Nuclear bodies of heat-stressed cells.

Images

  • ab159958 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159958 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159958.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up