Description

  • Product name

    Recombinant Human SYN4 protein (Tagged)
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MDFRTACEETKTGICLLQDGNQEPFKVRLHLAKDILMIQEQDVICVSGEP FYSGERTVTIRRQTVGGFGLSIKGGAEHNIPVVVSKISKEQRAELSGLLF IGDAILQINGINVRKCRHEEVVQVLRNAGEEVTLTVSFLKRAPAFLKLPL NEDCACAPSDQSSGTSSPLCDSGLHLNYHPNNTDTLSCSSWPTSPGLRWE KRWCDLRLIPLLHSRFSQYVPGTDLSRQNAFQVIAVDGVCTGIIQCLSAE DCVDWLQAIATNISNLTKHNIKKINRNFPVNQQIVYMGWCEAREQDPLQD RVYSPTFLALRGSCLYKFLAPPVTTWDWTRAEKTFSVYEIMCKILKDSDL LDRRKQCFTVQSESGEDLYFSVELESDLAQWERAFQTATFLEVERIQCKT YACVLESHLMGLTIDFSTGFICFDAATKAVLWRYKFSQLKGSSDDGKSKI KFLFQNPDTKQIEAKELEFSNLFAVLHCIHSFFAAKVACLDPLFLGNQAT ASTAASSATTSKAKYTT
    • Predicted molecular weight

      63 kDa including tags
    • Amino acids

      1 to 517
    • Additional sequence information

      N-terminal 10xHis-tagged and C-terminal Myc-tagged.

Specifications

Our Abpromise guarantee covers the use of ab239577 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

General Info

  • Alternative names

    • G1SYN
    • Gamma 1 syntrophin
    • Gamma-1-syntrophin
    • gamma1 syntrophin
    • OTTHUMP00000226271
    • OTTHUMP00000226272
    • OTTHUMP00000226273
    • OTTHUMP00000226275
    • SNTG 1
    • Sntg1
    • SNTG1_HUMAN
    • SYN 4
    • SYN4
    • Synotrophin gamma 1
    • Syntrophin 4
    • Syntrophin gamma 1
    • Syntrophin-4
    see all
  • Function

    Adapter protein that binds to and probably organizes the subcellular localization of a variety of proteins. May link various receptors to the actin cytoskeleton and the dystrophin glycoprotein complex (By similarity). May participate in regulating the subcellular location of diacylglycerol kinase-zeta to ensure that diacylglycerol is rapidly inactivated following receptor activation.
  • Tissue specificity

    Brain specific. In CNS, it is expressed in the perikaryon and proximal portion of the neuronal processes. Strong expression in the hippocampus, neuron-rich dendate granule cells, and pyramidal cell layers. Highly expressed in neurons of the cerebral cortex. Also expressed in the cerebellar cortex, deep cerebellar nuclei, thalamus, and basal ganglia. No expression in muscle cells.
  • Sequence similarities

    Belongs to the syntrophin family.
    Contains 1 PDZ (DHR) domain.
    Contains 1 PH domain.
  • Domain

    The PDZ domain binds to the last three or four amino acids of DGKZ. The association with dystrophin or related proteins probably leaves the PDZ domain available to recruit proteins to the membrane.
  • Cellular localization

    Cytoplasm > cytoskeleton. Nucleus. Mainly cytoplasmic and weakly nuclear.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel analysis of ab239577.

References

ab239577 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239577.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up