Overview

  • Product name

    Recombinant Human Synapsin I protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      EIFGGLDICAVEALHGKDGRDHIIEVVGSSMPLIGDHQDEDKQLIVELVV NKMAQALPRQRQRDASPGRGSHGQTPSPGALPLGRQTSQ
    • Molecular weight

      36 kDa including tags
    • Amino acids

      362 to 450

Specifications

Our Abpromise guarantee covers the use of ab152720 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Brain protein 4.1
    • SYN 1
    • SYN 1a
    • SYN 1b
    • SYN I
    • SYN1
    • SYN1_HUMAN
    • SYN1a
    • SYN1b
    • Synapsin 1
    • Synapsin I
    • Synapsin-1
    • Synapsin1
    • SynapsinI
    • SYNI
    see all
  • Function

    Neuronal phosphoprotein that coats synaptic vesicles, binds to the cytoskeleton, and is believed to function in the regulation of neurotransmitter release. The complex formed with NOS1 and CAPON proteins is necessary for specific nitric-oxid functions at a presynaptic level.
  • Involvement in disease

    Defects in SYN1 are a cause of epilepsy X-linked with variable learning disabilities and behavior disorders [MIM:300491]. XELBD is characterized by variable combinations of epilepsy, learning difficulties, macrocephaly, and aggressive behavior.
  • Sequence similarities

    Belongs to the synapsin family.
  • Post-translational
    modifications

    Substrate of at least four different protein kinases. It is probable that phosphorylation plays a role in the regulation of synapsin-1 in the nerve terminal. Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Cell junction > synapse. Golgi apparatus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152720 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152720.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up