Recombinant Human Synaptojanin 2 protein (ab160233)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGGKAGNKGAVGIRFQFHSTSFCFICSHLTAGQSQVKERNEDYKEITQKL CFPMGRNVFSHDYVFWCGDFNYRIDLTYEEVFYFVKRQDWKKLLEFDQLQ LQKSSGKIFKDFHEGAINFGPTYKYDVGSAAYDTSDKCRTPAWTDRVLWW RKKHPFDKTAGELNLLDSDLDVDTKVRHTWSPGALQYYGRAELQASDHRP VLAIVEVEVQEVDVGARERVFQEVSSFQGPLDATVVVNLQSPTLEEKNEF PEDLRTELMQTLGSYGTIVLVRINQGQMLVTFADSHSALSVLDVDGMKVK GRAVKIRPKTKDWLKGLREEIIRKRDSMAPVSPTANSCLLEENFDFTSLD YESEGDILEDDEDYLVDEFNQPGVSDSELGGDDLSDVPGPTALAPPSKSP ALTKKKQHPTYKDDADLVELKRELEAVGEFRHRSPSRSLSVPNRPRPPQP PQRPPPPTGLMVKKSASDASISSGTHGQYSILQTARLLPGAPQQPPKART GISKPYNVKQIKTTNAQEAEAAIRCLLEARGGASEEALSAVAPRDLEASS EPEPTPGAAKPETPQAPPLLPRRPPPRVPAIKKPTLRRTGKPLSPEEQFE QQTVHFTIGPPETSVEAPPVVTAPRVPPVPKPRTFQPGKAAERPSHRKPA SDEAPPGAGASVPPPLEAPPLVPKVPPRRKKSAPAAFHLQVLQSNSQLLQ GLTYNSSDSPSGHPPAAGTVFPQGDFLSTSSATSPDSDGTKAMKPEAAPL LGDYQDPFWNLLHHPKLLNNTWLSKSSDPLDSGTRSPKRDPIDPVSAGAS AAKAELPPDHGHKTLGHWVTISDQEKRTALQVFDPLAKT
    • Amino acids
      1 to 839
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160233 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 4
    • 5-trisphosphate 5-phosphatase 2
    • Inositol phosphate 5' phosphatase 2
    • INPP 5H
    • INPP5H
    • KIAA0348
    • MGC44422
    • SJ2
    • Synaptic inositol 1 4 5 trisphosphate 5 phosphatase 2
    • Synaptic inositol-1
    • Synaptojanin-2
    • Synaptojanin2
    • SYNJ 2
    • Synj2
    • SYNJ2_HUMAN
    see all
  • Function
    Inositol 5-phosphatase which may be involved in distinct membrane trafficking and signal transduction pathways. May mediate the inhibitory effect of Rac1 on endocytosis.
  • Sequence similarities
    Belongs to the synaptojanin family.
    In the central section; belongs to the inositol-1,4,5-trisphosphate 5-phosphatase family.
    Contains 1 RRM (RNA recognition motif) domain.
    Contains 1 SAC domain.
  • Cellular localization
    Membrane. Predominantly associated with the particulate fractions.
  • Information by UniProt

Images

  • ab160233 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160233 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160233.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up