Overview

  • Product name

    Recombinant Human Synaptojanin protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      KISNPKGWVTFEEEEDFGVKGKSKSACSDLLGNQPSSFSGSNLTLNDDWN KGTNVSFCVLPSRRPPPPPVPLLPPGTSPPVDPFTTLASKASPTLDFTER
    • Amino acids

      1474 to 1573
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152928 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 4
    • 5-trisphosphate 5-phosphatase 1
    • Inositol 5' phosphatase
    • Inositol 5' phosphatase (synaptojanin 1)
    • INPP 5G
    • INPP5G
    • KIAA0910
    • PARK20
    • Polyphosphoinositide phosphatase
    • Synaptic inositol 1 4 5 trisphosphate 5 phosphatase 1
    • Synaptic inositol 145 trisphosphate 5 phosphatase 1
    • Synaptic inositol-1
    • Synaptojanin 1
    • Synaptojanin 1 polyphosphoinositide phosphatase
    • Synaptojanin-1
    • Synaptojanin1
    • Synj 1
    • Synj1
    • SYNJ1_HUMAN
    see all
  • Function

    Inositol 5-phosphatase which has a role in clathrin-mediated endocytosis.
  • Tissue specificity

    Concentrated at clathrin-coated endocytic intermediates in nerve terminals. Isoform 1 is more enriched than isoform 2 in developing brain as well as non-neuronal cells. Isoform 2 is very abundant in nerve terminals.
  • Sequence similarities

    Belongs to the synaptojanin family.
    In the central section; belongs to the inositol-1,4,5-trisphosphate 5-phosphatase family.
    Contains 1 RRM (RNA recognition motif) domain.
    Contains 1 SAC domain.
  • Domain

    Binds to EPS15 (a clathrin coat-associated protein) via a C-terminal domain containing three Asn-Pro-Phe (NPF) repeats.
    The C-terminal proline-rich region mediates binding to a variety of SH3 domain-containing proteins including AMPH, SH3GL1, SH3GL2, SH3GL3 and GRB2.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • ab152928 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152928 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152928.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up