Description

  • Product name

    Recombinant Human Synaptophysin protein
    See all Synaptophysin proteins and peptides
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYS GELQLNVDCANKTESDLSIEVEFEYPFRLHQVYFDAPTCRGGTTKVFLVG DYSSSAEFFVTVAVFAFLYSMGALATYIFLQNKYRENNKGPMLDFLATAV FAFMWLVSSSAWAKGLSDVKMATDPENIIKEMPVCRQTGNTCKELRDLVT SGLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFLRAPPGAPEKQPAPGD AYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPAGSGGSGYGPQGDYGQQ GYGPQGAPTSFSNQM
    • Predicted molecular weight

      61 kDa including tags
    • Amino acids

      1 to 313

Specifications

Our Abpromise guarantee covers the use of ab114166 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    ab114166 is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Major synaptic vesicle protein p38
    • MRX96
    • MRXSYP
    • Syn p38
    • Synaptophysin
    • Syp
    • SYPH
    • SYPH_HUMAN
    • SypI
    see all
  • Function

    Possibly involved in structural functions as organizing other membrane components or in targeting the vesicles to the plasma membrane. Involved in the regulation of short-term and long-term synaptic plasticity.
  • Tissue specificity

    Characteristic of a type of small (30-80 nm) neurosecretory vesicles, including presynaptic vesicles, but also vesicles of various neuroendocrine cells of both neuronal and epithelial phenotype.
  • Involvement in disease

    Mental retardation, X-linked, SYP-related
  • Sequence similarities

    Belongs to the synaptophysin/synaptobrevin family.
    Contains 1 MARVEL domain.
  • Domain

    The calcium-binding activity is thought to be localized in the cytoplasmic tail of the protein.
  • Post-translational
    modifications

    Ubiquitinated; mediated by SIAH1 or SIAH2 and leading to its subsequent proteasomal degradation.
  • Cellular localization

    Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane. Cell junction, synapse, synaptosome.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab114166, stained with Coomassie Blue.

References

ab114166 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114166.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up