Recombinant human SynCAM/CADM1 protein (ab167740)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Tags: His tag C-Terminus
- Suitable for: Functional Studies, SDS-PAGE, ELISA
Description
-
Product name
Recombinant human SynCAM/CADM1 protein
See all SynCAM/CADM1 proteins and peptides -
Biological activity
Measured by its binding ability in a functional ELISA. Immobilized rhCADM1 at 2 µg/ml (100 µl/well) can bind biotinylated Human CRTAM with a linear range of 12.5 – 500 ng/ml. -
Purity
> 95 % SDS-PAGE.
ab167740 was lyophilized from 0.22 µm filtered solution. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
QNLFTKDVTVIEGEVATISCQVNKSDDSVIQLLNPNRQTIYFRDFRPLKD SRFQLLNFSSSELKVSLTNVSISDEGRYFCQLYTDPPQESYTTITVLVPP RNLMIDIQKDTAVEGEEIEVNCTAMASKPATTIRWFKGNTELKGKSEVEE WSDMYTVTSQLMLKVHKEDDGVPVICQVEHPAVTGNLQTQRYLEVQYKPQ VHIQMTYPLQGLTREGDALELTCEAIGKPQPVMVTWVRVDDEMPQHAVLS GPNLFINNLNKTDNGTYRCEASNIVGKAHSDYMLYVYDPPTTIPPPTTTT TTTTTTTTTILTIITDSRAGEEGSIRAVDH -
Predicted molecular weight
39 kDa including tags -
Amino acids
45 to 374 -
Tags
His tag C-Terminus
-
Associated products
-
Positive Controls
Specifications
Our Abpromise guarantee covers the use of ab167740 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
ELISA
-
Form
Lyophilized -
Additional notes
This product was previously labelled as SynCAM
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.40
Constituents: 94% PBS, 5% TrehaloseThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionIt is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 100 ug/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.
General Info
-
Alternative names
- BL2
- Cadm1
- CADM1_HUMAN
see all -
Function
Mediates homophilic cell-cell adhesion in a Ca(2+)-independent manner. Also mediates heterophilic cell-cell adhesion with CADM3 and PVRL3 in a Ca(2+)-independent manner. Acts as a tumor suppressor in non-small-cell lung cancer (NSCLC) cells. Interaction with CRTAM promotes natural killer (NK) cell cytotoxicity and interferon-gamma (IFN-gamma) secretion by CD8+ cells in vitro as well as NK cell-mediated rejection of tumors expressing CADM3 in vivo. May contribute to the less invasive phenotypes of lepidic growth tumor cells. In mast cells, may mediate attachment to and promote communication with nerves. CADM1, together with MITF, is essential for development and survival of mast cells in vivo. May act as a synaptic cell adhesion molecule that drives synapse assembly. May be involved in neuronal migration, axon growth, pathfinding, and fasciculation on the axons of differentiating neurons. May play diverse roles in the spermatogenesis including in the adhesion of spermatocytes and spermatids to Sertoli cells and for their normal differentiation into mature spermatozoa. -
Sequence similarities
Belongs to the nectin family.
Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
Contains 1 Ig-like V-type (immunoglobulin-like) domain. -
Domain
The cytoplasmic domain appears to play a critical role in proapoptosis and tumor suppressor activity in NSCLC. -
Cellular localization
Cell membrane. Associates with perinuclear and plasma membranes in vivo. Localized to the basolateral plasma membrane of epithelial cells in gall bladder. - Information by UniProt
Images
-
Human CADM1, His Tag on SDS-PAGE under reducing (R) condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 95%.
-
Immobilized Cynomolgus CRTAM, Fc Tag at 5 µg/mL (100 µL/well) can bind Human CADM1, His Tag with a linear range of 0.6-5 ng/mL.
-
SDS-PAGE analysis of reduced ab167740 and staining overnight with Coomassie Blue. In DTT-reduced SDS-PAGE, SynCAM/CADM1 protein migrates as 38.5kDa, 50kDa and 55-85 kDa poly peptide due to different glycosylation.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab167740 has not yet been referenced specifically in any publications.