Overview

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected insect cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      ADPESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVES PELTTSRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLS DSERKMDPAEEDTNVYTEKHSDSLFKRTEHHHHHH
    • Molecular weight

      15 kDa including tags
    • Amino acids

      19 to 144
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain (NP_002989).

Specifications

Our Abpromise guarantee covers the use of ab222986 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 90 % SDS-PAGE.
    ab222986 was purified using conventional chromatography techniques.
  • Form

    Liquid
  • Additional notes

    Product previously known as Recombinant Human Syndecan 2/HSPG protein (His tag) .

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 10% Glycerol, PBS

General Info

  • Alternative names

    • CD362
    • Fibroglycan
    • Heparan sulfate proteoglycan core protein
    • HSPG
    • SDC2
    • SDC2_HUMAN
    • SYND2
    • Syndecan-2
    see all
  • Function

    Cell surface proteoglycan that bears heparan sulfate.
  • Sequence similarities

    Belongs to the syndecan proteoglycan family.
  • Post-translational
    modifications

    O-glycosylated with core 1 or possibly core 8 glycans. Contains heparan sulfate.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab222986.

References

ab222986 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222986.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up