Description

  • Product name

    Recombinant Human Synip protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MIGVSFEEAKSIITRAKLSTRLESAWEIAFIRQKSDNIQPENLSCTSLIE ASGEYGPQASTLSLFSSPPEILIPKTSSTPKTNNDILSSCEIKTGYNKTV QIPITSENSTVGLSNTDVASAWTENYGLQEKISLNPSVRFKAEKLEMALN YLGIQPTKEQHQALRQQVQADSKGTVSFGDFVQVARNLFCLQLDEVNVGA HEISNILDSQLLPCDSSEADEMERLKCERDDALKEVNTLKWPGQN
    • Amino acids

      1 to 245
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166014 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as Syntaxin-binding protein 4. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • FLJ16496
    • MGC149829
    • MGC50337
    • OTTHUMP00000082667
    • OTTHUMP00000227400
    • STX4-interacting protein
    • STXB4_HUMAN
    • Stxbp4
    • Synip
    • Syntaxin 4 interacting protein
    • Syntaxin 4-interacting protein
    • Syntaxin binding protein 4
    • Syntaxin-binding protein 4
    see all
  • Function

    Plays a role in the translocation of transport vesicles from the cytoplasm to the plasma membrane. Inhibits the translocation of SLC2A4 from intracellular vesicles to the plasma membrane by STX4A binding and preventing the interaction between STX4A and VAMP2. Stimulation with insulin disrupts the interaction with STX4A, leading to increased levels of SLC2A4 at the plasma membrane. May also play a role in the regulation of insulin release by pancreatic beta cells after stimulation by glucose.
  • Sequence similarities

    Contains 1 PDZ (DHR) domain.
    Contains 1 WW domain.
  • Post-translational
    modifications

    Phosphorylated on Ser-99 by PKB/AKT2 after insulin treatment. Phosphorylation on Ser-99 abolishes the interaction with STX4A (By similarity). Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • ab166014 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166014 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166014.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up