Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MNGRVDYLVTEEEINLTRGPSGLGFNIVGGTDQQYVSNDSGIYVSRIKEN GAAALDGRLQEGDKILSVNGQDLKNLLHQDAVDLFRNAGYAVSLRVQHRL QVQNGPIGHRGEGDPSGIPIFMVLVPVFALTMVAAWAFMRYRQQL
    • Amino acids

      1 to 145
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163067 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Arip2
    • FLJ11271
    • FLJ41973
    • Mitochondrial outer membrane protein 25
    • OMP25
    • synaptojanin 2 binding protein
    • SYNJ2BP
    see all
  • Relevance

    SYNJ2BP, also known as synaptojanin 2 binding protein, contains an N-terminal amphipathic helix, followed by a PDZ domain and a C-terminal transmembrane domain.
  • Cellular localization

    Mitochondrial outer membrane

Images

  • ab163067 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163067 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163067.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up