Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MKDRTQELRTAKDSDDDDDVAVTVDRDRFMDEFFEQVEEIRGFIDKIAEN VEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSI EQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQ RQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHS EIIKLENSIRELHDMFMDMAMLVESQTMWRGPCLTPRRPSSTRARRAGRK S
    • Molecular weight

      53 kDa including tags
    • Amino acids

      1 to 251

Specifications

Our Abpromise guarantee covers the use of ab132963 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 ug/ul.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • HPC 1
    • Neuron specific antigen HPC1
    • Neuron-specific antigen HPC-1
    • OTTHUMP00000174615
    • OTTHUMP00000174616
    • OTTHUMP00000174617
    • OTTHUMP00000174618
    • P35-1
    • STX1
    • STX1A
    • STX1A_HUMAN
    • SYN1A
    • Syntaxin 1A (brain)
    • Syntaxin 1A brain
    • Syntaxin-1A
    see all
  • Function

    Potentially involved in docking of synaptic vesicles at presynaptic active zones. May play a critical role in neurotransmitter exocytosis. May mediate Ca(2+)-regulation of exocytosis acrosomal reaction in sperm.
  • Tissue specificity

    Isoform 1 is highly expressed in embryonic spinal chord and ganglia and in adult cerebellum and cerebral cortex. Isoform 2 is expressed in heart, liver, fat, skeletal muscle, kidney and brain.
  • Involvement in disease

    Note=STX1A is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region.
  • Sequence similarities

    Belongs to the syntaxin family.
    Contains 1 t-SNARE coiled-coil homology domain.
  • Cellular localization

    Secreted and Cytoplasmic vesicle > secretory vesicle > synaptic vesicle membrane. Cell junction > synapse > synaptosome.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132963 stained with Coomassie Blue.

References

ab132963 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132963.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up