Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MRDRTHELRQGDDSSDEEDKERVALVVHPGTARLGSPDEEFFHKVRTIRQ TIVKLGNKVQELEKQQVTILATPLPEESMKQELQNLRDEIKQLGREIRLQ LKAIEPQKEEADENYNSVNTRMRKTQHGVLSQQFVELINKCNSMQSEYRE KNVERIRRQLKITNAGMVSDEELEQMLDSGQSEVFVSNILKDTQVTRQAL NEISARHSEIQQLERSIRELHDIFTFLATEVEMQGEMINRIEKNILSSAD YVERGQEHVKTALENQKKARKKKVLIAICVSITVVLLAVIIGVTVVG
    • Molecular weight

      61 kDa including tags
    • Amino acids

      1 to 297

Specifications

Our Abpromise guarantee covers the use of ab132537 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • NY REN 31 antigen
    • p35 2
    • PLACENTAL
    • Renal carcinoma antigen NY REN 31
    • Renal carcinoma antigen NY-REN-31
    • Stx4
    • STX4_HUMAN
    • STX4A
    • Syntaxin 4
    • Syntaxin 4A
    • syntaxin 4A (placental)
    • Syntaxin-4
    see all
  • Function

    Plasma membrane t-SNARE that mediates docking of transport vesicles. Necessary for the translocation of SLC2A4 from intracellular vesicles to the plasma membrane. Together with STXB3 and VAMP2, may also play a role in docking/fusion of intracellular GLUT4-containing vesicles with the cell surface in adipocytes (By similarity). May also play a role in docking of synaptic vesicles at presynaptic active zones.
  • Tissue specificity

    Expressed in neutrophils and neutrophil-differentiated HL-60 cells. Expression in neutrophils increases with differentiation.
  • Sequence similarities

    Belongs to the syntaxin family.
    Contains 1 t-SNARE coiled-coil homology domain.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE Stained with Coomassie Blue.

References

ab132537 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132537.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up