Overview

  • Product name

    Recombinant Human Syntaxin 7 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MSYTPGVGGDPAQLAQRISSNIQKITQCSVEIQRTLNQLGTPQDSPELRQ QLQQKQQYTNQLAKETDKYIKEFGSLPTTPSEQRQRKIQKDRLVAEFTTS LTNFQKVQRQAAEREKEFVARVRASSRVSGSFPEDSSKERNLVSWESQTQ PQVQVQDEEITEDDLRLIHERESSIRQLEADIMDINEIFKDLGMMIHEQG DVIDSIEANVENAEVHVQQANQQLSRAADYQRKSRKTLCIIILILVIGVA IISLIIWGLNH
    • Molecular weight

      54 kDa including tags
    • Amino acids

      1 to 261

Specifications

Our Abpromise guarantee covers the use of ab152867 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • STX7
    • STX7_HUMAN
    • Syn7
    • Syntaxin-7
  • Function

    May be involved in protein trafficking from the plasma membrane to the early endosome (EE) as well as in homotypic fusion of endocytic organelles. Mediates the endocytic trafficking from early endosomes to late endosomes and lysosomes.
  • Tissue specificity

    Highest expression is found in placenta followed by heart, skeletal muscle, kidney and brain. Low expression is found in pancreas, lung and liver.
  • Sequence similarities

    Belongs to the syntaxin family.
    Contains 1 t-SNARE coiled-coil homology domain.
  • Cellular localization

    Early endosome membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152867 stained with Coomassie Blue.

References

ab152867 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152867.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up