Recombinant Human Syntaxin-binding protein 4 (ab166014)

Overview

  • Product name
    Recombinant Human Syntaxin-binding protein 4
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MIGVSFEEAKSIITRAKLSTRLESAWEIAFIRQKSDNIQPENLSCTSLIE ASGEYGPQASTLSLFSSPPEILIPKTSSTPKTNNDILSSCEIKTGYNKTV QIPITSENSTVGLSNTDVASAWTENYGLQEKISLNPSVRFKAEKLEMALN YLGIQPTKEQHQALRQQVQADSKGTVSFGDFVQVARNLFCLQLDEVNVGA HEISNILDSQLLPCDSSEADEMERLKCERDDALKEVNTLKWPGQN
    • Amino acids
      1 to 245
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166014 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ16496
    • MGC149829
    • MGC50337
    • OTTHUMP00000082667
    • OTTHUMP00000227400
    • STX4-interacting protein
    • STXB4_HUMAN
    • Stxbp4
    • Synip
    • Syntaxin 4 interacting protein
    • Syntaxin 4-interacting protein
    • Syntaxin binding protein 4
    • Syntaxin-binding protein 4
    see all
  • Function
    Plays a role in the translocation of transport vesicles from the cytoplasm to the plasma membrane. Inhibits the translocation of SLC2A4 from intracellular vesicles to the plasma membrane by STX4A binding and preventing the interaction between STX4A and VAMP2. Stimulation with insulin disrupts the interaction with STX4A, leading to increased levels of SLC2A4 at the plasma membrane. May also play a role in the regulation of insulin release by pancreatic beta cells after stimulation by glucose.
  • Sequence similarities
    Contains 1 PDZ (DHR) domain.
    Contains 1 WW domain.
  • Post-translational
    modifications
    Phosphorylated on Ser-99 by PKB/AKT2 after insulin treatment. Phosphorylation on Ser-99 abolishes the interaction with STX4A (By similarity). Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab166014 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166014 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166014.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up