Overview

  • Product name

    Recombinant Human Syntenin 2 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMSSLYPSLEDLKVDQAIQAQVRASPKM PALPVQATAISPPPVLYPNLAELENYMGLSLSSQEVQESLLQIPEGDSTA VSGPGPGQMVAPVTGYSLGVRRAEIKPGVREIHLCKDERGKTGLRLRKVD QGLFVQLVQANTPASLVGLRFGDQLLQIDGRDCAGWSSHKAHQVVKKASG DKIVVVVRDRPFQRTVTMHKDSMGHVGFVIKKGKIVSLVKGSSAARNGLL TNHYVCEVDGQNVIGLKDKKIMEILATAGNVVTLTIIPSVIYEHMVKKLP PVLLHHTMDHSIPDA
    • Molecular weight

      34 kDa including tags
    • Amino acids

      1 to 292
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab137151 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 95 % SDS-PAGE.
    ab137151 is purified using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names

    • MDA9
    • Melanoma differentiation associated gene 9
    • Pro TGF alpha cytoplasmic domain interacting protein 18
    • SDCB2_HUMAN
    • SDCBP2
    • SITAC
    • SITAC18
    • ST 2
    • Syndecan binding protein (syntenin) 2
    • Syndecan binding protein 2
    • Syndecan-binding protein 2
    • Syntenin-2
    see all
  • Sequence similarities

    Contains 2 PDZ (DHR) domains.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab137151.

References

ab137151 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab137151.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up