Description

  • Product name

    Recombinant Human SYT1 protein
  • Purity

    > 85 % SDS-PAGE.
    ab108130 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKV FLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDR FSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYV PTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKN TLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNLE HHHHHH
    • Predicted molecular weight

      30 kDa including tags
    • Amino acids

      136 to 382
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab108130 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.0308% DTT, 0.316% Tris HCl, 20% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • DKFZp781D2042
    • FLJ42519
    • p65
    • SVP65
    • Synaptotagmin 2
    • Synaptotagmin I
    • Synaptotagmin II
    • Synaptotagmin-1
    • SYT
    • Syt1
    • SYT1_HUMAN
    • Syt2
    • SytI
    see all
  • Function

    May have a regulatory role in the membrane interactions during trafficking of synaptic vesicles at the active zone of the synapse. It binds acidic phospholipids with a specificity that requires the presence of both an acidic head group and a diacyl backbone. A Ca(2+)-dependent interaction between synaptotagmin and putative receptors for activated protein kinase C has also been reported. It can bind to at least three additional proteins in a Ca(2+)-independent manner; these are neurexins, syntaxin and AP2.
  • Sequence similarities

    Belongs to the synaptotagmin family.
    Contains 2 C2 domains.
  • Domain

    The first C2 domain mediates Ca(2+)-dependent phospholipid binding.
    The second C2 domain mediates interaction with SV2A and STN2.
  • Cellular localization

    Cytoplasmic vesicle > secretory vesicle > synaptic vesicle membrane. Cytoplasmic vesicle > secretory vesicle > chromaffin granule membrane. Cytoplasm. Synaptic vesicles and chromaffin granules.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab108130.

References

ab108130 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab108130.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up