Overview

  • Product name

    Recombinant Human SYT11 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSWSCCHQQAEKKQKNPPYKFIHMLKGIS IYPETLSNKKKIIKVRRDKDGPGREGGRRNLLVDAAEAGLLSRDKDPRGP SSGSCIDQLPIKMDYGEELRSPITSLTPGESKTTSPSSPEEDVMLGSLTF SVDYNFPKKALVVTIQEAHGLPVMDDQTQGSDPYIKMTILPDKRHRVKTR VLRKTLDPVFDETFTFYGIPYSQLQDLVLHFLVLSFDRFSRDDVIGEVMV PLAGVDPSTGKVQLTRDIIKRNIQKCISRGELQVSLSYQPVAQRMTVVVL KARHLPKMDITGLSGNPYVKVNVYYGRKRIAKKKTHVKKCTLNPIFNESF IYDIPTDLLPDISIEFLVIDFDRTTKNEVVGRLILGAHSVTASGAEHWRE VCESPRKPVAKWHSLSEY
    • Molecular weight

      47 kDa including tags
    • Amino acids

      37 to 431
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_689493.

Specifications

Our Abpromise guarantee covers the use of ab207142 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 80 % SDS-PAGE.
    ab207142 was purified using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 50% PBS, 50% Glycerol

General Info

  • Alternative names

    • DKFZp781D015
    • KIAA0080
    • MGC10881
    • MGC17226
    • Synaptotagmin 11
    • Synaptotagmin 12
    • Synaptotagmin XI
    • Synaptotagmin-11
    • Synaptotagmin11
    • Synaptotagmin12
    • SynaptotagminXI
    • SYT 11
    • SYT 12
    • Syt XI
    • Syt11
    • SYT11_HUMAN
    • SYT12
    • SytXI
    see all
  • Function

    May be involved in Ca(2+)-dependent exocytosis of secretory vesicles through Ca(2+) and phospholipid binding to the C2 domain or may serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis.
  • Sequence similarities

    Belongs to the synaptotagmin family.
    Contains 2 C2 domains.
  • Post-translational
    modifications

    Ubiquitinated and targeted to the proteasome complex for degradation.
  • Cellular localization

    Membrane. Cell junction > synapse. Cytoplasmic vesicle > secretory vesicle > synaptic vesicle membrane. In substantia nigra, observed in neuronal cell bodies and neurites. Found in the core of the Lewy bodies in the brain of sporadic Parkinson disease patients.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab207142.

References

ab207142 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab207142.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up