Description

  • Product name

    Recombinant Human SYT16 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MTRERMMGEKLFYLSHLHPEGEMKVTLVLEPRSNISSGGSPLSPSAVSHS DSTSSTQSLSHGGAPELLVGLSYNATTGRLSVEMIKGSHFRNLAVNRAPD TYGKLFLLNSVGQEMSRCKTSIRRGQPNPVYKETFVFQVALFQLSDVTLM ISVYNRRTMKRKEMIGWIALGQNSSGEEEQDHWEEMKETKGQQICRWHTL LES
    • Amino acids

      1 to 203
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164444 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Chr14 synaptotagmin
    • CHR14SYT
    • Strep14
    • Synaptotagmin 14 like protein
    • Synaptotagmin 14-like protein
    • Synaptotagmin 16
    • Synaptotagmin XIV like
    • Synaptotagmin XIV related
    • Synaptotagmin XIV related protein
    • Synaptotagmin XIV-related protein
    • Synaptotagmin XVI
    • Synaptotagmin-16
    • SYT14L
    • Syt14r
    • Syt16
    • SYT16_HUMAN
    • Yt14r
    see all
  • Function

    May be involved in the trafficking and exocytosis of secretory vesicles in non-neuronal tissues. Is Ca(2+)-independent.
  • Tissue specificity

    Expressed in brain.
  • Sequence similarities

    Belongs to the synaptotagmin family.
    Contains 2 C2 domains.
  • Information by UniProt

Images

  • ab164444 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164444 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164444.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up