Overview

  • Product name

    Recombinant Human SYVN1/HRD1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MFRTAVMMAASLALTGAVVAHAYYLKHQFYPTVVYLTKSSPSMAVLYIQA FVLVFLLGKVMGKVFFGQLRAAEMEHLLERSWYAVTETCLAFTVFRDDFS PRFVALFTLLLFLKCFHWLAEDRVDFMERSPNISWLFHCRIVSLMFLLGI LDFLFVSHAYHSILTRGASVQLVFGFEYAILMTMVLTIFIKYVLHSVDLQ SENPWDNKAVYMLYTELFTGFIKVLLYMAFMTIMIKVHTFPLFAIRPMYL AMRQFKKAVTDAIMSRRAIRNMNTLYPDATPEELQAMDNVCIICREEMVT GAKRLPCNHIFHTSCLRSWFQRQQTCPTCRMDVLRASLPAQSPPPPEPAD QGPPPAPHPPPLLPQPPNFPQGLLPPFPPGMFPLWPPMGPFPPVPPPPSS GEAVAPPSTSAAALSRPSGAATTTAAGTSATAASATASGPGSGSAPEAGP APGFPFPPPWMGMPLPPPFAFPPMPVPPAGFAGLTPEELRALEGHERQHL EARLQSLRNIHTLLDAAMLQINQYLTVLASLGPPRPATSVNSTEETATTV VAAASSTSIPSSEATTPTPGASPPAPEMERPPAPESVGTEEMPEDGEPDA AELRRRRLQKLESPVAH
    • Molecular weight

      94 kDa including tags
    • Amino acids

      1 to 617
    • Tags

      GST tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132449 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/ml.
    Best used within three months from the date of receipt.

     This product was previously labelled as SYVN1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 1200010C09Rik
    • DER3
    • E3 ubiquitin-protein ligase synoviolin
    • HMG coA reductase degradation 1 homolog
    • HRD1
    • KIAA1810
    • MGC40372
    • OTTHUMP00000230429
    • OTTHUMP00000230430
    • OTTHUMP00000230431
    • OTTHUMP00000230432
    • Synovial apoptosis inhibitor 1
    • Synovial apoptosis inhibitor 1, synoviolin
    • SYNOVIOLIN
    • Synoviolin 1
    • Synoviolin 1 isoform b
    • SYVN1
    • SYVN1_HUMAN
    see all
  • Function

    Acts as an E3 ubiquitin-protein ligase which accepts ubiquitin specifically from endoplasmic reticulum-associated UBC7 E2 ligase and transfers it to substrates, promoting their degradation. Component of the endoplasmic reticulum quality control (ERQC) system also called ER-associated degradation (ERAD) involved in ubiquitin-dependent degradation of misfolded endoplasmic reticulum proteins. Also promotes the degradation of normal but naturally short-lived proteins such as SGK. Protects cells from ER stress-induced apoptosis. Protects neurons from apoptosis induced by polyglutamine-expanded huntingtin (HTT) or unfolded GPR37 by promoting their degradation. Sequesters p53/TP53 in the cytoplasm and promotes its degradation, thereby negatively regulating its biological function in transcription, cell cycle regulation and apoptosis.
  • Tissue specificity

    Ubiquitously expressed, with highest levels in liver and kidney (at protein level). Up-regulated in synovial tissues from patients with rheumatoid arthritis (at protein level).
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Belongs to the HRD1 family.
    Contains 1 RING-type zinc finger.
  • Domain

    The RING-type zinc finger is required for E3 ligase activity.
  • Post-translational
    modifications

    Not N-glycosylated.
    Auto-ubiquitinated.
  • Cellular localization

    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132449 stained with Coomassie Blue.

References

ab132449 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132449.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up