Description

  • Product name

    Recombinant Human T-bet / Tbx21 protein
  • Purity

    > 90 % SDS-PAGE.
    The final product was refolded using unique “temperature shift inclusion body refolding” technology and chromatographically purified.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGHHHHHHGNLYFQGGEFGIVEPGCGDMLTGTEPMPGSD EGRAPGADPQHRYFYPEPGAQDADERRGGGSLGSPYPGGALVPAPPSRFL GAYAYPPRPQAAGFPGAGESFPPPADAEGYQPGEGYAAPDPRAGLYPGPR EDYALPAGLEVSGKLRVALNNHLLWSKFNQHQTEMIITKQGRRMFPFLSF TVAGLEPTSHYRMFVDVVLVDQHHWRYQSGKWVQCGKAEGSMPGNRLYVH PDSPNTGAHWMRQEVSFGKLKLTNNKGASNNVTQMIVLQSLHKYQPRLHI VEVNDGEPEAACNASNTHIFTFQETQFIAVTAYQNAEITQLKIDNNPFAK GFRENFESMYTSVDTSIPSPPGPNCQFLGGDHYSPLLPNQYPVPSRFYPD LPGQAKDVVPQAYWLGAPRDHSYEAEFRAVSMKPAFLPSAPGPTMSYYRG QEVLAPGAGWPVAPQYPPKMGPASWFRPMRTLPMEPGPGGSEGRGPEDQG PPLVWTEIAPIRPESSDSGLGEGDSKRRRVSPYPSSGDSSSPAGAPSPFD KEAEGQFYNYFPN
    • Predicted molecular weight

      61 kDa including tags
    • Amino acids

      2 to 535
    • Tags

      His-T7 tag N-Terminus
    • Additional sequence information

      T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal. NP_037483.

Specifications

Our Abpromise guarantee covers the use of ab182815 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

General Info

  • Alternative names

    • T bet
    • T box 21
    • T box expressed in T cells
    • T box protein 21
    • T box transcription factor TBX21
    • T cell specific T box transcription factor
    • T cell specific T box transcription factor T bet
    • T PET
    • T-box protein 21
    • T-box transcription factor TBX21
    • T-cell-specific T-box transcription factor T-bet
    • TBET
    • TBLYM
    • TBX 21
    • Tbx21
    • TBX21_HUMAN
    • TPET
    • Transcription factor TBLYM
    see all
  • Function

    Transcription factor that controls the expression of the TH1 cytokine, interferon-gamma. Initiates TH1 lineage development from naive TH precursor cells both by activating TH1 genetic programs and by repressing the opposing TH2 programs.
  • Tissue specificity

    T-cell specific.
  • Involvement in disease

    Genetic variations in TBX21 are associated with susceptibility to asthma with nasal polyps and aspirin intolerance (ANPAI) [MIM:208550]. A condition consisting of asthma, aspirin sensitivity and nasal polyposis. Nasal polyposis is due to chronic inflammation of the paranasal sinus mucosa, leading to protrusion of edematous polyps into the nasal cavities.
  • Sequence similarities

    Contains 1 T-box DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

References

ab182815 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182815.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up